Step 1: Installing Modeller Software
Download and install latest version of Modeller software:http://salilab.org/modeller/download_installation.html
After registration, you will get an academic licence for installation.
Step 2: Download and install python:http://www.python.org/download/releases/2.4/
Step 3: Paste your raw protein sequence and search against pdb database using BLASTP program
http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&BLAST_PROGRAMS=blastp&PAGE_TYPE=BlastSearch&SHOW_DEFAULTS=on&LINK_LOC=blasthome
Note: Choose database search set as protein data bank (pdb). find the best
template hit. The template hit should have atleast greater than 35% of identity. Note down the pdb id (Eg:1BDM).
Step 4: Now download the pdb file from pdb database:http://www.rcsb.org/pdb/home/home.do
Step 5: Go to C:\\Program Files\Modeller folder\
Now, copy the downloaded pdb file in modeller folder. Now rename the pdb file name as "1bdm.pdb"
Step 6: Now, open new notepad file, copy and paste the following program
>P1;TvLDH
sequence:TvLDH:::::::0.00: 0.00
MSEAAHVLITGAAGQIGYILSHWIASGELYGDRQVYLHLLDIPPAMNRLTALTMELEDCAFPHLAGFVATTDPKA
AFKDIDCAFLVASMPLKPGQVRADLISSNSVIFKNTGEYLSKWAKPSVKVLVIGNPDNTNCEIAMLHAKNLKPEN
FSSLSMLDQNRAYYEVASKLGVDVKDVHDIIVWGNHGESMVADLTQATFTKEGKTQKVVDVLDHDYVFDTFFKKI
GHRAWDILEHRGFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVPEGNPYGIKPGVVFSFPCNVDKEGKIHVV
EGFKVNDWLREKLDFTEKDLFHEKEIALNHLAQGG*
Now, replace the existing sequence with your sequence.
Only, sequence has to be replaced. Now, save the notepad file as
"TvLDH.ali". Give the file name within the double quote.
Step 7: Now, open new notepad file, copy and paste the following program
from modeller import *
env =
environ()
aln =
alignment(env)
mdl =
model(env, file='1bdm', model_segment=('FIRST:A','LAST:A'))
aln.append_model(mdl, align_codes='1bdmA', atom_files='1bdm.pdb')
aln.append(file='TvLDH.ali', align_codes='TvLDH')
aln.align2d()
aln.write(file='TvLDH-1bdmA.ali', alignment_format='PIR')
aln.write(file='TvLDH-1bdmA.pap', alignment_format='PAP')
Now, save the notepad file as "align.py". Give
the file name within the double quote. It will automatically changed into
python format.
Now, run the "align.py" by double clicking it.
It will run now and create 'TvLDH-1bdmA.ali' and 'TvLDH-1bdmA.pap' file. Depend
on the sequence length, it will take time to complete.
Step 8: Now, open new notepad file, copy and paste the
following program
from modeller import *
from modeller.automodel import *
env =
environ()
a = automodel(env, alnfile='TvLDH-1bdmA.ali',
knowns='1bdmA', sequence='TvLDH',
assess_methods=(assess.DOPE, assess.GA341))
a.starting_model = 1
a.ending_model = 5
a.make()
Now, save the notepad file as "model.py". Give
the file name within the double quote.
Run the "model.py" file by double clicking it.
It will run and generate 5 pdb
model.
Now check the model efficiency and accurecy by validating it. Go
to SAVES server. http://nihserver.mbi.ucla.edu/SAVES/. upload the modelled pdb file, and run all
the program.
Check the ramachandran plot value (should be greater than 95%) and errat value (should be
great then 90%). If it is less, Do model optimization, energy minimization and
protein (molecular dynamics) simulation.